PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A13G1009
Common NameMYB1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 294aa    MW: 33202.1 Da    PI: 8.204
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A13G1009genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+++++ +G g+W++ ++  g+ R++k+c++rw +yl
      Gh_A13G1009 14 KGAWTKEEDQRLINYIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding59.85.7e-1967111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++
      Gh_A13G1009  67 RGNFTEEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.3E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.054961IPR017930Myb domain
SMARTSM007171.8E-131363IPR001005SANT/Myb domain
SuperFamilySSF466898.8E-3013108IPR009057Homeodomain-like
PfamPF002492.0E-151461IPR001005SANT/Myb domain
CDDcd001671.14E-101661No hitNo description
PROSITE profilePS5129429.42762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2865117IPR009057Homeodomain-like
SMARTSM007174.6E-1866114IPR001005SANT/Myb domain
PfamPF002493.9E-1767111IPR001005SANT/Myb domain
CDDcd001675.98E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0090378Biological Processseed trichome elongation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLINYIR VHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TEEEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLISRG  120
IDPQTHRPLN QTANTNTVTA PTELDFRNSP TSVSKSSSIK NPSLDFNYNE FQFKSNTDSL  180
EEPNCTASSG MTTDEEQQEQ LHKKQQYGPS NGQDINLELS IGIVSADSSR VSNANSAESK  240
PKVDNNNFQF LEQAMVAKAV CLCWQLGFGT SEICRNCQNS NSNGFYSYCR PLDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.80920.0boll
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO4373260.0
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCOTMYBA0.0L04497.1 Gossypium hirsutum MYB1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012462415.10.0PREDICTED: transcription repressor MYB6-like
SwissprotP813951e-100MYB30_ANTMA; Myb-related protein 330
TrEMBLQ434360.0Q43436_G
STRINGPOPTR_0013s11360.11e-117(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.12e-96myb domain protein 3
Publications ? help Back to Top
  1. Loguerico LL,Zhang JQ,Wilkins TA
    Differential regulation of six novel MYB-domain genes defines two distinct expression patterns in allotetraploid cotton (Gossypium hirsutum L.).
    Mol. Gen. Genet., 1999. 261(4-5): p. 660-71
    [PMID:10394903]
  2. Cedroni ML,Cronn RC,Adams KL,Wilkins TA,Wendel JF
    Evolution and expression of MYB genes in diploid and polyploid cotton.
    Plant Mol. Biol., 2003. 51(3): p. 313-25
    [PMID:12602863]